(data stored in ACNUC7421 zone)

EMBL: AP011115.PE547

AP011115.PE547       Location/Qualifiers
FT   CDS             564241..565353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48794"
FT                   /db_xref="GOA:C1ARW7"
FT                   /db_xref="InterPro:IPR031928"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARW7"
FT                   /protein_id="BAH48794.1"
FT                   /translation="MRGVARGSKRKGNPDADLPGDDAPADLAAVRRDDALIDAIAGDGP
FT                   VATDSPEQYELALLLTNWRADIVSTPMPTGPLLDDVIAAIDASDNARSARSAARGKLRL
FT                   LRPIAGAAAAIAVVMGGATIFSYNAEPGDPLWSVKSVVFSQQADSTVAQIDTTTQLQEA
FT                   ERLIAAGDAESAKNLLDGAADRAGGVRDADKRNELDVWRAKLAAELEKIAPTTPPATTT
FT                   PGTTTTDTPTQTTSSPATVPGTEPLPGTQLPPDLQLPGLPPNSMPPLPTTTLPPETLPY
FT                   ISPEPTITMVPPPQAPLPEPSDNPITQPPPPEPSDNPITQPPPSEPSDNPITQPPPPEP
FT                   SDNPATQPPVEQPPPQEPSSEPLAPPVPTS"
     MRGVARGSKR KGNPDADLPG DDAPADLAAV RRDDALIDAI AGDGPVATDS PEQYELALLL        60
     TNWRADIVST PMPTGPLLDD VIAAIDASDN ARSARSAARG KLRLLRPIAG AAAAIAVVMG       120
     GATIFSYNAE PGDPLWSVKS VVFSQQADST VAQIDTTTQL QEAERLIAAG DAESAKNLLD       180
     GAADRAGGVR DADKRNELDV WRAKLAAELE KIAPTTPPAT TTPGTTTTDT PTQTTSSPAT       240
     VPGTEPLPGT QLPPDLQLPG LPPNSMPPLP TTTLPPETLP YISPEPTITM VPPPQAPLPE       300
     PSDNPITQPP PPEPSDNPIT QPPPSEPSDN PITQPPPPEP SDNPATQPPV EQPPPQEPSS       360
     EPLAPPVPTS                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page