(data stored in ACNUC7421 zone)

EMBL: AP011115.PE549

AP011115.PE549       Location/Qualifiers
FT   CDS             complement(565979..567364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48796"
FT                   /db_xref="GOA:C1ARW9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR029228"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR038536"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARW9"
FT                   /protein_id="BAH48796.1"
FT                   /translation="MHRMRRMDRSVAVRHPRRGERHMTDIIDYADKVWKGEANQNAYHH
FT                   GDLRTEGMHCIAEGTYMWPAFGNVYVFPTKAGLFVYDTGDRRTAEDLFAATRRISEQPV
FT                   HTAVYSHGHVDHVFGMEPFDTEARERGWTRPTVLAHENVTRRFDRYKETRGYNGIINQR
FT                   QFQAPNLVWPDEYRYPDVTFADQTTLAVDDLQVQLHHARGETDDAAIAWIPDRKILCCG
FT                   DFFIWASPNAGNPQKVQRFAHEWARTLRWMADLGAEILLPGHGLPVLGADRIRTTLTDA
FT                   AELLEILHGRTLEMMNAGATLDEVVHSVAAPGELLRKPYLAPSYDEPEFVIRNVWRLYG
FT                   GWYDGNPAHLKSAPRADLAREIADLGGGAAQLAERARALLARGEHRLAGHFAQMATDAD
FT                   PQNRDSHQVRVDVFGQLEQGATSTMAKGVYGWAVAESRAFLDGSDHATELKAKTAGRAR
FT                   WAF"
     MHRMRRMDRS VAVRHPRRGE RHMTDIIDYA DKVWKGEANQ NAYHHGDLRT EGMHCIAEGT        60
     YMWPAFGNVY VFPTKAGLFV YDTGDRRTAE DLFAATRRIS EQPVHTAVYS HGHVDHVFGM       120
     EPFDTEARER GWTRPTVLAH ENVTRRFDRY KETRGYNGII NQRQFQAPNL VWPDEYRYPD       180
     VTFADQTTLA VDDLQVQLHH ARGETDDAAI AWIPDRKILC CGDFFIWASP NAGNPQKVQR       240
     FAHEWARTLR WMADLGAEIL LPGHGLPVLG ADRIRTTLTD AAELLEILHG RTLEMMNAGA       300
     TLDEVVHSVA APGELLRKPY LAPSYDEPEF VIRNVWRLYG GWYDGNPAHL KSAPRADLAR       360
     EIADLGGGAA QLAERARALL ARGEHRLAGH FAQMATDADP QNRDSHQVRV DVFGQLEQGA       420
     TSTMAKGVYG WAVAESRAFL DGSDHATELK AKTAGRARWA F                           461
//

If you have problems or comments...

PBIL Back to PBIL home page