(data stored in ACNUC7421 zone)

EMBL: AP011115.PE55

AP011115.PE55        Location/Qualifiers
FT   CDS             45145..45558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48302"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS53"
FT                   /protein_id="BAH48302.1"
FT                   /translation="MTAAGNGSLKIGNGGFLSIDTVGVAARQHCGTGMLLLTATAIRRR
FT                   PRQDTDSCGGGADMVPAGHIEESIEAGVIATGALLGQDRRRGGQQLRVRRLRRMSSSGY
FT                   CGGVGRHEGPFATSARTAGQVRSARGRGLASHC"
     MTAAGNGSLK IGNGGFLSID TVGVAARQHC GTGMLLLTAT AIRRRPRQDT DSCGGGADMV        60
     PAGHIEESIE AGVIATGALL GQDRRRGGQQ LRVRRLRRMS SSGYCGGVGR HEGPFATSAR       120
     TAGQVRSARG RGLASHC                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page