(data stored in ACNUC7421 zone)

EMBL: AP011115.PE551

AP011115.PE551       Location/Qualifiers
FT   CDS             568812..569990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05510"
FT                   /product="CaiB/BaiF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48798"
FT                   /db_xref="GOA:C1ARX1"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARX1"
FT                   /protein_id="BAH48798.1"
FT                   /translation="MPDSANAPDDLPLAGIMVVDFGQYIAAPGAAQALADLGADVLKIE
FT                   GPGGDQARGIGVYGEAIMRAYNRRKRSIVLDLKTEVDLRHARVLIARADVVIHNLRPGV
FT                   MEKLGLSADEIHELNPTVILAAVSGFGTDGPSRRRPGLDIAAQAETGMMSVTGEADGDP
FT                   QRVGFPLVDHATSYVVTQAVLSALFRRERTGLGDDIDVSLLDVAIDLQCVNWGEYSITG
FT                   VAPHRRGNGQPTAAPAADVFPTADGSIVISAYTEQRFAQLCGLAGQPDLPSDPRFVDNP
FT                   SRVAHRGELLAALAPFFAGLDTEAALAALTSVGIVAGAVRTYDLVPSAPDVIASGIFAT
FT                   GSTGDGHTYSIPGLPYRSRSTPRTADAGRVPELGEHSNEIVAHYRLGEYSLT"
     MPDSANAPDD LPLAGIMVVD FGQYIAAPGA AQALADLGAD VLKIEGPGGD QARGIGVYGE        60
     AIMRAYNRRK RSIVLDLKTE VDLRHARVLI ARADVVIHNL RPGVMEKLGL SADEIHELNP       120
     TVILAAVSGF GTDGPSRRRP GLDIAAQAET GMMSVTGEAD GDPQRVGFPL VDHATSYVVT       180
     QAVLSALFRR ERTGLGDDID VSLLDVAIDL QCVNWGEYSI TGVAPHRRGN GQPTAAPAAD       240
     VFPTADGSIV ISAYTEQRFA QLCGLAGQPD LPSDPRFVDN PSRVAHRGEL LAALAPFFAG       300
     LDTEAALAAL TSVGIVAGAV RTYDLVPSAP DVIASGIFAT GSTGDGHTYS IPGLPYRSRS       360
     TPRTADAGRV PELGEHSNEI VAHYRLGEYS LT                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page