(data stored in ACNUC7421 zone)

EMBL: AP011115.PE555

AP011115.PE555       Location/Qualifiers
FT   CDS             complement(573571..574827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05550"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48802"
FT                   /db_xref="GOA:C1ARX5"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARX5"
FT                   /protein_id="BAH48802.1"
FT                   /translation="MNAISSAGERLTFGAPSSPWLRVGQVGAALAAGMGIGRFVYTPVL
FT                   PLMEAQAGLTPSAGAALATANYSGYLVGALAGIAIPGVMRSAATMRISLLALTVTLALM
FT                   PVASNETSWGVLRFIAGVASALVFVLAVGAMHSHLGGQAAHLSGWAFGGIGAGIALSGF
FT                   VVLVLRTMSTWESVWWAAALLTAICTFAAWTLTPQPRATAAAGERRKSPEQGVRSFGAL
FT                   FVSYLLEGVGYIIAGTFLVAAIDRTAGSIAGSGAWVLVGLAALPSGPLWASLGRRWSRP
FT                   ILLVIALTVQAVGIALPAAADGVWPALVSAFLFGGTFLGISQMSLAIGADLQIPRAVAI
FT                   LTSGYSLGQIVGPLVVTPLLSDGYHLALLVAAGIVLAAALAAAALPVLTWGLPKRAGAT
FT                   ATGAWSDCRSRYRTPPRGG"
     MNAISSAGER LTFGAPSSPW LRVGQVGAAL AAGMGIGRFV YTPVLPLMEA QAGLTPSAGA        60
     ALATANYSGY LVGALAGIAI PGVMRSAATM RISLLALTVT LALMPVASNE TSWGVLRFIA       120
     GVASALVFVL AVGAMHSHLG GQAAHLSGWA FGGIGAGIAL SGFVVLVLRT MSTWESVWWA       180
     AALLTAICTF AAWTLTPQPR ATAAAGERRK SPEQGVRSFG ALFVSYLLEG VGYIIAGTFL       240
     VAAIDRTAGS IAGSGAWVLV GLAALPSGPL WASLGRRWSR PILLVIALTV QAVGIALPAA       300
     ADGVWPALVS AFLFGGTFLG ISQMSLAIGA DLQIPRAVAI LTSGYSLGQI VGPLVVTPLL       360
     SDGYHLALLV AAGIVLAAAL AAAALPVLTW GLPKRAGATA TGAWSDCRSR YRTPPRGG         418
//

If you have problems or comments...

PBIL Back to PBIL home page