(data stored in ACNUC7421 zone)

EMBL: AP011115.PE559

AP011115.PE559       Location/Qualifiers
FT   CDS             complement(577792..578478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48806"
FT                   /db_xref="GOA:C1ARX9"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARX9"
FT                   /protein_id="BAH48806.1"
FT                   /translation="MTGPSRYGAIAFTAPVAERQKATGSIHWYGRRRAQGENVGRPDEL
FT                   DTRVTALIRSTDSFFIATVTPSGWPYIQHRGGPPGFVHVPNSSTITLADYPGNQQFVTI
FT                   GNLDENDRVALFFIDYPTRTRVKVYGRADIVERADDPELIERILATPDGVGRAGCDRAL
FT                   VVHVEALDRNCTKNIPPKYGEARMRESLALARKGLQDEVDALKSRNAALEREIAQLRGG
FT                   SDGQRG"
     MTGPSRYGAI AFTAPVAERQ KATGSIHWYG RRRAQGENVG RPDELDTRVT ALIRSTDSFF        60
     IATVTPSGWP YIQHRGGPPG FVHVPNSSTI TLADYPGNQQ FVTIGNLDEN DRVALFFIDY       120
     PTRTRVKVYG RADIVERADD PELIERILAT PDGVGRAGCD RALVVHVEAL DRNCTKNIPP       180
     KYGEARMRES LALARKGLQD EVDALKSRNA ALEREIAQLR GGSDGQRG                    228
//

If you have problems or comments...

PBIL Back to PBIL home page