(data stored in ACNUC7421 zone)

EMBL: AP011115.PE56

AP011115.PE56        Location/Qualifiers
FT   CDS             46705..47097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48303"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS54"
FT                   /protein_id="BAH48303.1"
FT                   /translation="MFAIVARFSVLWIDEVGMASVRDRTHPAARLHFKCAGTGSAGAPV
FT                   PDPPHRMIAHTHVLLTPLDRAPRTFDQPLTWNAVPPAAVGGTAPRGLDGGGATDSAGEN
FT                   KQEQGDIEVHGTGPSRGAECCCRCGS"
     MFAIVARFSV LWIDEVGMAS VRDRTHPAAR LHFKCAGTGS AGAPVPDPPH RMIAHTHVLL        60
     TPLDRAPRTF DQPLTWNAVP PAAVGGTAPR GLDGGGATDS AGENKQEQGD IEVHGTGPSR       120
     GAECCCRCGS                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page