(data stored in ACNUC7421 zone)

EMBL: AP011115.PE562

AP011115.PE562       Location/Qualifiers
FT   CDS             complement(581181..581921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48809"
FT                   /db_xref="GOA:C1ARY2"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARY2"
FT                   /protein_id="BAH48809.1"
FT                   /translation="MTIERLLTTHFPDDPVMDAAFASALLRRTGRDPNAPGLVRIYSPA
FT                   RTLSFGRLDAIRPQFPAAAAAARRHGFTPVVRGAGGRAAAYHEQTLVVEIFSRDTEGII
FT                   GARPRFERITPRIAAVLRSLGVDARIGPVPGEYCPGDWTVNGEGRVKLAGTAQRIVAGA
FT                   WLFGFELVVSDSNPVRAVLTDVNAALELDFDPGTAASLTDMNPGVTLEQVRAAILAETG
FT                   GLHERAADPGLLDEAANLRDAHVA"
     MTIERLLTTH FPDDPVMDAA FASALLRRTG RDPNAPGLVR IYSPARTLSF GRLDAIRPQF        60
     PAAAAAARRH GFTPVVRGAG GRAAAYHEQT LVVEIFSRDT EGIIGARPRF ERITPRIAAV       120
     LRSLGVDARI GPVPGEYCPG DWTVNGEGRV KLAGTAQRIV AGAWLFGFEL VVSDSNPVRA       180
     VLTDVNAALE LDFDPGTAAS LTDMNPGVTL EQVRAAILAE TGGLHERAAD PGLLDEAANL       240
     RDAHVA                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page