(data stored in ACNUC7421 zone)

EMBL: AP011115.PE563

AP011115.PE563       Location/Qualifiers
FT   CDS             582148..582585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48810"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARY3"
FT                   /protein_id="BAH48810.1"
FT                   /translation="MLLRSSVVALPCAVAAVLSASPAQATPSSGVTAQILFETTVPAVA
FT                   GSSAGTDLTLRRIEIASGGTTGWHYHDGPVYAFVESGVLSRTLQDCTKAVTTAGQAITE
FT                   DHGSDHVHEGSNLGTEPLVLLAFYTQPEGKPLSEDAPAPAC"
     MLLRSSVVAL PCAVAAVLSA SPAQATPSSG VTAQILFETT VPAVAGSSAG TDLTLRRIEI        60
     ASGGTTGWHY HDGPVYAFVE SGVLSRTLQD CTKAVTTAGQ AITEDHGSDH VHEGSNLGTE       120
     PLVLLAFYTQ PEGKPLSEDA PAPAC                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page