(data stored in ACNUC7421 zone)

EMBL: AP011115.PE568

AP011115.PE568       Location/Qualifiers
FT   CDS             586130..586543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48815"
FT                   /db_xref="GOA:C1ARY8"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARY8"
FT                   /protein_id="BAH48815.1"
FT                   /translation="MDRTPSTPIRLPDAALAFLGEYHLGTLTTLRKNGTPHVVAVGFTW
FT                   DQEHGLARVITNGSSQKALNAERGGYGAVSQVDGPRWMTLEGPARVLTDPESVADAVAR
FT                   YAARYRQPRVNPTRVVVEIAVSRVLGSAALRHD"
     MDRTPSTPIR LPDAALAFLG EYHLGTLTTL RKNGTPHVVA VGFTWDQEHG LARVITNGSS        60
     QKALNAERGG YGAVSQVDGP RWMTLEGPAR VLTDPESVAD AVARYAARYR QPRVNPTRVV       120
     VEIAVSRVLG SAALRHD                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page