(data stored in ACNUC7421 zone)

EMBL: AP011115.PE57

AP011115.PE57        Location/Qualifiers
FT   CDS             complement(47795..48211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48304"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS55"
FT                   /protein_id="BAH48304.1"
FT                   /translation="MSAATDRQWAVRDAVLRWLLAKTTEGYRSPILDADAIGAEVGWVA
FT                   SPLTRDEVVDASMFLFKENYVTGVPVMGIGIPRPMLTVAGRRVAKAGKPLRYKVDAHEA
FT                   KVRRHLGGTAGRDIRDDDGGSEVKERMARPVTRR"
     MSAATDRQWA VRDAVLRWLL AKTTEGYRSP ILDADAIGAE VGWVASPLTR DEVVDASMFL        60
     FKENYVTGVP VMGIGIPRPM LTVAGRRVAK AGKPLRYKVD AHEAKVRRHL GGTAGRDIRD       120
     DDGGSEVKER MARPVTRR                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page