(data stored in ACNUC7421 zone)

EMBL: AP011115.PE572

AP011115.PE572       Location/Qualifiers
FT   CDS             complement(589550..590245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05720"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48819"
FT                   /db_xref="GOA:C1ARZ2"
FT                   /db_xref="InterPro:IPR025637"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARZ2"
FT                   /protein_id="BAH48819.1"
FT                   /translation="MSGPYGPNDPNGQWAQGQQPGQGNPDQSGGQYGAPQYGQQPPAQP
FT                   WGQQPGQPQQPGQPQWGQQPQQPGQPQWGQQPQPGQLGQPGPGQWGQQPQQPGQPQWGQ
FT                   QPGQPQQWGPAPGQQQWGQPPSSGKSKLPLIIGGVVALLVIVGIALVLAFTVFGTDTLD
FT                   QKAAEDGVERIVTDSYGAENVSGVTCPSGQEVKKGNSFTCSLTVDGEKKQVTLTFTDDK
FT                   GTYEVSRPS"
     MSGPYGPNDP NGQWAQGQQP GQGNPDQSGG QYGAPQYGQQ PPAQPWGQQP GQPQQPGQPQ        60
     WGQQPQQPGQ PQWGQQPQPG QLGQPGPGQW GQQPQQPGQP QWGQQPGQPQ QWGPAPGQQQ       120
     WGQPPSSGKS KLPLIIGGVV ALLVIVGIAL VLAFTVFGTD TLDQKAAEDG VERIVTDSYG       180
     AENVSGVTCP SGQEVKKGNS FTCSLTVDGE KKQVTLTFTD DKGTYEVSRP S                231
//

If you have problems or comments...

PBIL Back to PBIL home page