(data stored in ACNUC7421 zone)

EMBL: AP011115.PE576

AP011115.PE576       Location/Qualifiers
FT   CDS             complement(594568..594834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48823"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARZ6"
FT                   /protein_id="BAH48823.1"
FT                   /translation="MGRERVGAEIRDHGLRLTDLHGSDIEVGASDIAFDTGPGTAAPVN
FT                   ARLVALIREAEAGGNRQWSGEALLADLRSQRGPRKPAGKRQRS"
     MGRERVGAEI RDHGLRLTDL HGSDIEVGAS DIAFDTGPGT AAPVNARLVA LIREAEAGGN        60
     RQWSGEALLA DLRSQRGPRK PAGKRQRS                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page