(data stored in ACNUC7421 zone)

EMBL: AP011115.PE58

AP011115.PE58        Location/Qualifiers
FT   CDS             49076..50764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00580"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48305"
FT                   /db_xref="GOA:C1AS56"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS56"
FT                   /protein_id="BAH48305.1"
FT                   /translation="MCRELMEQKMNRPGLVTRRPAPASLSSKRGRAMLRVILLPLDIVE
FT                   SADPVPVPAVDEVEPFLPARISAPTATGDDGPQAQLLAFRHIVDRRSPPVTFGLALDGQ
FT                   RAPDGRRRPYVGPPATCLSLWEVPGNGLVLACEELTPDRAGSLIDRHHDPLRGGGSPEF
FT                   WAAIEAFLRPFGLTPDASPMDVFPRLNTRLPSSAVYRPLRSLTIHGPHRTDSDTLEGLI
FT                   IEVHTDGVDTVRRLVDEPGTSPCGGAASRSYRGLLRWHRVPLIDRASRLGSGIAIREDA
FT                   RALAVDVGAPVIGRQYVDRGTREMLYCLIGWVALRAQHSADHRRVLSLLRNRRQLSEGG
FT                   ALAGLGDIAAARTRMIETRLLQAHPADDHRLPPRIESTHLRSTLVHRTADEIAFLHTEL
FT                   GKLCDSAESSLLPHAVASARERRSTLVSVAAAGALFVTSLHAAVAASPVDLQRWGFTVA
FT                   VAAAIGAVALLEVVSRRRPSRTPLKPTPVAPPHASPVVTPVRDLERRRLESIFPFETQV
FT                   WRTVPSRRGMTPTFRECLEANDLSVGEPSNSLLVMASPTFRPAPK"
     MCRELMEQKM NRPGLVTRRP APASLSSKRG RAMLRVILLP LDIVESADPV PVPAVDEVEP        60
     FLPARISAPT ATGDDGPQAQ LLAFRHIVDR RSPPVTFGLA LDGQRAPDGR RRPYVGPPAT       120
     CLSLWEVPGN GLVLACEELT PDRAGSLIDR HHDPLRGGGS PEFWAAIEAF LRPFGLTPDA       180
     SPMDVFPRLN TRLPSSAVYR PLRSLTIHGP HRTDSDTLEG LIIEVHTDGV DTVRRLVDEP       240
     GTSPCGGAAS RSYRGLLRWH RVPLIDRASR LGSGIAIRED ARALAVDVGA PVIGRQYVDR       300
     GTREMLYCLI GWVALRAQHS ADHRRVLSLL RNRRQLSEGG ALAGLGDIAA ARTRMIETRL       360
     LQAHPADDHR LPPRIESTHL RSTLVHRTAD EIAFLHTELG KLCDSAESSL LPHAVASARE       420
     RRSTLVSVAA AGALFVTSLH AAVAASPVDL QRWGFTVAVA AAIGAVALLE VVSRRRPSRT       480
     PLKPTPVAPP HASPVVTPVR DLERRRLESI FPFETQVWRT VPSRRGMTPT FRECLEANDL       540
     SVGEPSNSLL VMASPTFRPA PK                                                562
//

If you have problems or comments...

PBIL Back to PBIL home page