(data stored in ACNUC7421 zone)

EMBL: AP011115.PE580

AP011115.PE580       Location/Qualifiers
FT   CDS             598293..599756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48827"
FT                   /db_xref="GOA:C1ASP5"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASP5"
FT                   /protein_id="BAH48827.1"
FT                   /translation="MNRHLHRIHRVDEIVFGRSADLRPSGVDRAMRFLSHAADKGVLWW
FT                   CVAALLGLVGGRARRGAVRGLLSLAMASGLANGILKPVFPRRRPPARAWTNVLRGVPIP
FT                   RSSSFPSGHSASAAAFTTGVALESPAAGAALAPLAAAVAYSRVHNGVHWPSDVLVGLML
FT                   GGAVASGTRRWWAVRTEDPAELGPAVDAPALPGGEGLLVLVNQESGPDTVDPSEEIATA
FT                   LPKAHVRALDTDRDFAEQLDAWVAETNPRALGVCGGDGTVVAVASAAARHTLPLAVFPG
FT                   GTLNHFARDAGVPEISDTATAVETGHAVLVDQAVVHTDVAEPAPFLNTASLGGYPDAVR
FT                   LREKWQPRYGKWPAACAAMIRILAAATPLAVTLDGRPVNVWMLFVGNGRYSPGDQVPMS
FT                   RPAITGGLLDVRYVRADRRASRPRLLFAAVTGTLGSSRVYVRSLVPRLTVRVNGAPVAL
FT                   ATDGEVVTDARRFEFRTVPGAIAVYRPQS"
     MNRHLHRIHR VDEIVFGRSA DLRPSGVDRA MRFLSHAADK GVLWWCVAAL LGLVGGRARR        60
     GAVRGLLSLA MASGLANGIL KPVFPRRRPP ARAWTNVLRG VPIPRSSSFP SGHSASAAAF       120
     TTGVALESPA AGAALAPLAA AVAYSRVHNG VHWPSDVLVG LMLGGAVASG TRRWWAVRTE       180
     DPAELGPAVD APALPGGEGL LVLVNQESGP DTVDPSEEIA TALPKAHVRA LDTDRDFAEQ       240
     LDAWVAETNP RALGVCGGDG TVVAVASAAA RHTLPLAVFP GGTLNHFARD AGVPEISDTA       300
     TAVETGHAVL VDQAVVHTDV AEPAPFLNTA SLGGYPDAVR LREKWQPRYG KWPAACAAMI       360
     RILAAATPLA VTLDGRPVNV WMLFVGNGRY SPGDQVPMSR PAITGGLLDV RYVRADRRAS       420
     RPRLLFAAVT GTLGSSRVYV RSLVPRLTVR VNGAPVALAT DGEVVTDARR FEFRTVPGAI       480
     AVYRPQS                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page