(data stored in ACNUC7421 zone)

EMBL: AP011115.PE585

AP011115.PE585       Location/Qualifiers
FT   CDS             complement(603342..603719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48832"
FT                   /db_xref="GOA:C1ASQ0"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASQ0"
FT                   /protein_id="BAH48832.1"
FT                   /translation="MALPRSIARFNRVVTNRVSRHVASILPGFAMVEHRGRKSGKSYHT
FT                   PVNVFVVDGRYRFALTYGARSDWVRNVVAAGGCTIVTRRRTVHLTDPRIGTDGTHSWAP
FT                   PGVRTVLEAISADQYLECSPG"
     MALPRSIARF NRVVTNRVSR HVASILPGFA MVEHRGRKSG KSYHTPVNVF VVDGRYRFAL        60
     TYGARSDWVR NVVAAGGCTI VTRRRTVHLT DPRIGTDGTH SWAPPGVRTV LEAISADQYL       120
     ECSPG                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page