(data stored in ACNUC7421 zone)

EMBL: AP011115.PE588

AP011115.PE588       Location/Qualifiers
FT   CDS             606379..606882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48835"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASQ3"
FT                   /protein_id="BAH48835.1"
FT                   /translation="MIIRKPLNGRSFTGRSAVAVGAVVFALGMSACSSDDASDTAAATS
FT                   AATSSAAEAAVAAPTSEELLGTLQLLVDPARPVDEKTVVVVDGDERRPNLEAMTAAMAN
FT                   YPVSFTVTDVQVEGDTATANVAIVSPHGTAAPTAWTWENVDGVWKVSDESTCTLLGMAR
FT                   AGCS"
     MIIRKPLNGR SFTGRSAVAV GAVVFALGMS ACSSDDASDT AAATSAATSS AAEAAVAAPT        60
     SEELLGTLQL LVDPARPVDE KTVVVVDGDE RRPNLEAMTA AMANYPVSFT VTDVQVEGDT       120
     ATANVAIVSP HGTAAPTAWT WENVDGVWKV SDESTCTLLG MARAGCS                     167
//

If you have problems or comments...

PBIL Back to PBIL home page