(data stored in ACNUC7421 zone)

EMBL: AP011115.PE59

AP011115.PE59        Location/Qualifiers
FT   CDS             50864..51622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00590"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48306"
FT                   /db_xref="GOA:C1AS57"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS57"
FT                   /protein_id="BAH48306.1"
FT                   /translation="MLVTSYPSWWQMLAVLSVAVVLSTAVGMERQLRQKSAGMRTHTLV
FT                   GLGAALFMIVSKYGFSDVLTEGLVTLDPSRVAGQIVSGIGFIGAGLVFVRRNKVRGLTT
FT                   AASIWLTAAIGTASGAGLILPAMFVTGCHFVIAFAYPVVVRYSRLGKSSQHLLRVRYAD
FT                   GTGALRRIISACTEHGLAVQGFATRHPDADAGAGGVLTRLRDNLDTAMPLASGVEVELE
FT                   LYGTTNLSELMTQLSVLDHVDGVHCDDPLE"
     MLVTSYPSWW QMLAVLSVAV VLSTAVGMER QLRQKSAGMR THTLVGLGAA LFMIVSKYGF        60
     SDVLTEGLVT LDPSRVAGQI VSGIGFIGAG LVFVRRNKVR GLTTAASIWL TAAIGTASGA       120
     GLILPAMFVT GCHFVIAFAY PVVVRYSRLG KSSQHLLRVR YADGTGALRR IISACTEHGL       180
     AVQGFATRHP DADAGAGGVL TRLRDNLDTA MPLASGVEVE LELYGTTNLS ELMTQLSVLD       240
     HVDGVHCDDP LE                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page