(data stored in ACNUC7421 zone)

EMBL: AP011115.PE591

AP011115.PE591       Location/Qualifiers
FT   CDS             608783..609619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48838"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASQ6"
FT                   /protein_id="BAH48838.1"
FT                   /translation="MSSESYYVPVGSEALGAPTPGSDQKVVVERFASTDLTISVWADTM
FT                   QHGAPPSALLVRALERCAAREDARLTRVVVEILGPIPIAELEVRSWVQRPGRRVELVVA
FT                   ELWTVGDRPRAVARGSAWRMETVDTSDAVHVVDPPLEPRSTGRDGAFGGIWNSGYLTTL
FT                   DWRWIAEMGCEGPGKLWAKPRPALVLGETMTPLERLFAIADIANGVGSKLDPAQWTFLN
FT                   TDLTVHIFRVPEGDWVGVSSETSIGPDGVGMCAGVLYDETGAVGRIAQTVQVRARP"
     MSSESYYVPV GSEALGAPTP GSDQKVVVER FASTDLTISV WADTMQHGAP PSALLVRALE        60
     RCAAREDARL TRVVVEILGP IPIAELEVRS WVQRPGRRVE LVVAELWTVG DRPRAVARGS       120
     AWRMETVDTS DAVHVVDPPL EPRSTGRDGA FGGIWNSGYL TTLDWRWIAE MGCEGPGKLW       180
     AKPRPALVLG ETMTPLERLF AIADIANGVG SKLDPAQWTF LNTDLTVHIF RVPEGDWVGV       240
     SSETSIGPDG VGMCAGVLYD ETGAVGRIAQ TVQVRARP                               278
//

If you have problems or comments...

PBIL Back to PBIL home page