(data stored in ACNUC7421 zone)

EMBL: AP011115.PE595

AP011115.PE595       Location/Qualifiers
FT   CDS             complement(611769..612626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48842"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR022111"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASR0"
FT                   /protein_id="BAH48842.1"
FT                   /translation="MAVPKIVLFYVFTPLADPEAIRLWQYTLAEAHDLTGRILVSEHGI
FT                   NATVGGDIRDVKRYVKGTRSYAPFKDADIKWSDGLGNDFPRLSVKVRPEIVTFGAPGEL
FT                   KVDADGVVGGGTHLAPEEVHRLVEGRGDDVVFFDGRNGFEAEIGRFRDAVVPDVSTTRD
FT                   FVHELDSGKYDHLKDKAVVTYCTGGVRCEVLSSLMRSRGFGEVYQLDGGIVRYGEAFGD
FT                   TGLWEGSLYVFDKRMTIEFSDQAKTLGRCTRCGGPTSRYENLPDDRGRELVLVCAGCTE
FT                   NRAG"
     MAVPKIVLFY VFTPLADPEA IRLWQYTLAE AHDLTGRILV SEHGINATVG GDIRDVKRYV        60
     KGTRSYAPFK DADIKWSDGL GNDFPRLSVK VRPEIVTFGA PGELKVDADG VVGGGTHLAP       120
     EEVHRLVEGR GDDVVFFDGR NGFEAEIGRF RDAVVPDVST TRDFVHELDS GKYDHLKDKA       180
     VVTYCTGGVR CEVLSSLMRS RGFGEVYQLD GGIVRYGEAF GDTGLWEGSL YVFDKRMTIE       240
     FSDQAKTLGR CTRCGGPTSR YENLPDDRGR ELVLVCAGCT ENRAG                       285
//

If you have problems or comments...

PBIL Back to PBIL home page