(data stored in ACNUC7421 zone)

EMBL: AP011115.PE598

AP011115.PE598       Location/Qualifiers
FT   CDS             616948..617889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48845"
FT                   /db_xref="InterPro:IPR008492"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="InterPro:IPR038389"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASR3"
FT                   /protein_id="BAH48845.1"
FT                   /translation="MSSSEFPVTPAGPDDDTPDTADDGATDSGVPVLRDPVLVAAFEGW
FT                   NDAGDAASGAVEHLELTWDAQPLAELDSEEYYDYQVNRPTVRQVDGVTREIVWPATRLS
FT                   VCSPPGSDRDVVLLRGIEPNMRWRSFCEDLLELIDQLQINTVVILGALLADTPHTRPVP
FT                   VTGSAYSSEAAERFKIEQTRYEGPTGITGVLQDACVRAGVPAVSFWAAVPHYVSQPPNP
FT                   KATVALLQRVEDVLDIEVPLGELPSQADDWQEAVTEMTADDEEIGDYVRSLEERGDAET
FT                   DISEAISKIDGDALAAEFERYLRRRGPGSFGL"
     MSSSEFPVTP AGPDDDTPDT ADDGATDSGV PVLRDPVLVA AFEGWNDAGD AASGAVEHLE        60
     LTWDAQPLAE LDSEEYYDYQ VNRPTVRQVD GVTREIVWPA TRLSVCSPPG SDRDVVLLRG       120
     IEPNMRWRSF CEDLLELIDQ LQINTVVILG ALLADTPHTR PVPVTGSAYS SEAAERFKIE       180
     QTRYEGPTGI TGVLQDACVR AGVPAVSFWA AVPHYVSQPP NPKATVALLQ RVEDVLDIEV       240
     PLGELPSQAD DWQEAVTEMT ADDEEIGDYV RSLEERGDAE TDISEAISKI DGDALAAEFE       300
     RYLRRRGPGS FGL                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page