(data stored in ACNUC7421 zone)

EMBL: AP011115.PE599

AP011115.PE599       Location/Qualifiers
FT   CDS             617886..619037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05990"
FT                   /product="putative drug resistance efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48846"
FT                   /db_xref="GOA:C1ASR4"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASR4"
FT                   /protein_id="BAH48846.1"
FT                   /translation="MTRNSSESLRSSLQRTALYAGGFLGPFGGGVVASILPEIGDDLGV
FT                   SASAAAGSLTAYLLPFALLMLVSGTLGARWGQMRTVRIAYGVYLLSSLACFAAPTLPLF
FT                   LGARVLQGCSNSFTTPLLLAALAASTPKKHLGRALGIFGAFQAAGQSSAPLVGGLAAEV
FT                   DWRLAFLVIALVAAVLGLVGVPDSPPAEPGAARPRLRDALTPSVLRIGVVALLGWGALG
FT                   GLSFLVAFRAEDVFGLSPTQRGLLLTGFGVAGILTARLVGGVIDKFGARAAVLIGAFGG
FT                   AALVAAAGTVSLLPVVAVAWFAAGTAGQFILVGVNAAVLGSPGPNRGGAVSVVQALRFT
FT                   GNALAPITLTPVYAVSPAAGFLLPALLLAVLAPLLMPRDRPPA"
     MTRNSSESLR SSLQRTALYA GGFLGPFGGG VVASILPEIG DDLGVSASAA AGSLTAYLLP        60
     FALLMLVSGT LGARWGQMRT VRIAYGVYLL SSLACFAAPT LPLFLGARVL QGCSNSFTTP       120
     LLLAALAAST PKKHLGRALG IFGAFQAAGQ SSAPLVGGLA AEVDWRLAFL VIALVAAVLG       180
     LVGVPDSPPA EPGAARPRLR DALTPSVLRI GVVALLGWGA LGGLSFLVAF RAEDVFGLSP       240
     TQRGLLLTGF GVAGILTARL VGGVIDKFGA RAAVLIGAFG GAALVAAAGT VSLLPVVAVA       300
     WFAAGTAGQF ILVGVNAAVL GSPGPNRGGA VSVVQALRFT GNALAPITLT PVYAVSPAAG       360
     FLLPALLLAV LAPLLMPRDR PPA                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page