(data stored in ACNUC7421 zone)

EMBL: AP011115.PE604

AP011115.PE604       Location/Qualifiers
FT   CDS             complement(624912..625352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48851"
FT                   /db_xref="InterPro:IPR021607"
FT                   /db_xref="InterPro:IPR023159"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASR9"
FT                   /protein_id="BAH48851.1"
FT                   /translation="MGYLHTARSKFTIASWSESVITDIDGEGTTAGDTYYPARGATRAD
FT                   VEYSYSGDIEGTSTVAYLIAYKADAAPVLGLERFEGSIGGHDGTCVFQHLGSQDQGSVS
FT                   ARIEVVPGMGTGGLTDLRGSADLSIAGPGDGGFEFVLSYDVG"
     MGYLHTARSK FTIASWSESV ITDIDGEGTT AGDTYYPARG ATRADVEYSY SGDIEGTSTV        60
     AYLIAYKADA APVLGLERFE GSIGGHDGTC VFQHLGSQDQ GSVSARIEVV PGMGTGGLTD       120
     LRGSADLSIA GPGDGGFEFV LSYDVG                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page