(data stored in ACNUC7421 zone)

EMBL: AP011115.PE606

AP011115.PE606       Location/Qualifiers
FT   CDS             complement(626237..626449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48853"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASS1"
FT                   /protein_id="BAH48853.1"
FT                   /translation="MSSSDTAGETEFPASMGKVSRRELASHGYTRFDQLTMVTAKELLK
FT                   IHGVGPKAIRILEEELAKRGLGFAG"
     MSSSDTAGET EFPASMGKVS RRELASHGYT RFDQLTMVTA KELLKIHGVG PKAIRILEEE        60
     LAKRGLGFAG                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page