(data stored in ACNUC7421 zone)

EMBL: AP011115.PE607

AP011115.PE607       Location/Qualifiers
FT   CDS             complement(626524..627114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06070"
FT                   /product="putative Xre family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48854"
FT                   /db_xref="GOA:C1ASS2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASS2"
FT                   /protein_id="BAH48854.1"
FT                   /translation="MTQELGLDGVIRQRIRGLRVARGWSLDALAARCFLSPSTLSRIET
FT                   GHRRIALDQLVPIARALGTTLDQLVESVDDEDVVIRPMPEQTRGLTTWLLSRERALHGA
FT                   TVAKMRITPERPAGPEHVCVHPGHEWFTVLSGTARLQLGERTILIEAGAAAEFSTMVPH
FT                   SIGAHDGPVEILTIFDHDGERAHLHTADDAPPA"
     MTQELGLDGV IRQRIRGLRV ARGWSLDALA ARCFLSPSTL SRIETGHRRI ALDQLVPIAR        60
     ALGTTLDQLV ESVDDEDVVI RPMPEQTRGL TTWLLSRERA LHGATVAKMR ITPERPAGPE       120
     HVCVHPGHEW FTVLSGTARL QLGERTILIE AGAAAEFSTM VPHSIGAHDG PVEILTIFDH       180
     DGERAHLHTA DDAPPA                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page