(data stored in ACNUC7421 zone)

EMBL: AP011115.PE608

AP011115.PE608       Location/Qualifiers
FT   CDS             627163..628014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48855"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASS3"
FT                   /protein_id="BAH48855.1"
FT                   /translation="MTQHSHHHAHHHDEHTPAHETALADLLELDAEIFGSYLDQVAEWA
FT                   GRRVGEAPRRVVDVGAGTGVGSLALARRFPAAEVIAIDRSEVMLERVRAAALGQGMADR
FT                   VSGVHADLNAGWPAVEAADVVWAASSLHEVSDPDRVLRDMYAALNPDGVLVLVEMDALP
FT                   RLLPDDLGLGRPGLESRCHEALARMDWNAHPNWRAHVERAGFGDVEQRSFTSEARPAPQ
FT                   STGRYAHTFLRRVRSALDGQLAADDRDTLDRLLSDDGPDSVLHRGDLTVRGSRTAWTAR
FT                   RP"
     MTQHSHHHAH HHDEHTPAHE TALADLLELD AEIFGSYLDQ VAEWAGRRVG EAPRRVVDVG        60
     AGTGVGSLAL ARRFPAAEVI AIDRSEVMLE RVRAAALGQG MADRVSGVHA DLNAGWPAVE       120
     AADVVWAASS LHEVSDPDRV LRDMYAALNP DGVLVLVEMD ALPRLLPDDL GLGRPGLESR       180
     CHEALARMDW NAHPNWRAHV ERAGFGDVEQ RSFTSEARPA PQSTGRYAHT FLRRVRSALD       240
     GQLAADDRDT LDRLLSDDGP DSVLHRGDLT VRGSRTAWTA RRP                         283
//

If you have problems or comments...

PBIL Back to PBIL home page