(data stored in ACNUC7421 zone)

EMBL: AP011115.PE609

AP011115.PE609       Location/Qualifiers
FT   CDS             628372..629529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48856"
FT                   /db_xref="GOA:C1ASS4"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASS4"
FT                   /protein_id="BAH48856.1"
FT                   /translation="MSMGVGLRIGSVVSTAVVASNDPGSPDPVVIVRDTVLHMCPDGTA
FT                   ILGGSAPHTIGDTHTVSGFLPRVGDPAGVAVGDGSRYRAEDLVAGAMRCLLRECEPLPD
FT                   HGGRTGGAPDIMATYPTRWDSAAVAALRDALDYADMSYLSLVSDAEAAAAWFESEIAER
FT                   PGQLVGIYHVDDTGSTVALIRSGVEAGKAFRFSSGGSPTAQIATALGAFGWLPGNLDAV
FT                   VVTGDGLIARDSAAVHGFAATIGEKFDVRCVVGPGPEQTSALGAAIRAAGFNPTTHKVT
FT                   PIGLPPSYDVTEVIDAVVGEPVPSTSPTPTRPATRTQNPATAAAVGASPARASGGTAVA
FT                   TPPEPRAVAQSGEDSDSASRASWLVAAAVGLALVLVAIVFVLFVL"
     MSMGVGLRIG SVVSTAVVAS NDPGSPDPVV IVRDTVLHMC PDGTAILGGS APHTIGDTHT        60
     VSGFLPRVGD PAGVAVGDGS RYRAEDLVAG AMRCLLRECE PLPDHGGRTG GAPDIMATYP       120
     TRWDSAAVAA LRDALDYADM SYLSLVSDAE AAAAWFESEI AERPGQLVGI YHVDDTGSTV       180
     ALIRSGVEAG KAFRFSSGGS PTAQIATALG AFGWLPGNLD AVVVTGDGLI ARDSAAVHGF       240
     AATIGEKFDV RCVVGPGPEQ TSALGAAIRA AGFNPTTHKV TPIGLPPSYD VTEVIDAVVG       300
     EPVPSTSPTP TRPATRTQNP ATAAAVGASP ARASGGTAVA TPPEPRAVAQ SGEDSDSASR       360
     ASWLVAAAVG LALVLVAIVF VLFVL                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page