(data stored in ACNUC7421 zone)

EMBL: AP011115.PE61

AP011115.PE61        Location/Qualifiers
FT   CDS             complement(52161..52730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00610"
FT                   /product="putative signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48308"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS59"
FT                   /protein_id="BAH48308.1"
FT                   /translation="MSAPFDITDTIIGSGARAGSGIRDDAHRLLRECRAKAALVTELSL
FT                   DGPLSAKTYAGVNLPAARRRRHPAASEPPWGRDEVEALPSGSALLVVTRGPNRGEWFLL
FT                   DQPVTTIGRHIDSDIYLDDTTVGRRHAQIRCDNDTFRVTDVGSLNGTYRNRAPVDTALL
FT                   ADGDEIKIGKFRLAFLITPPSAATDQ"
     MSAPFDITDT IIGSGARAGS GIRDDAHRLL RECRAKAALV TELSLDGPLS AKTYAGVNLP        60
     AARRRRHPAA SEPPWGRDEV EALPSGSALL VVTRGPNRGE WFLLDQPVTT IGRHIDSDIY       120
     LDDTTVGRRH AQIRCDNDTF RVTDVGSLNG TYRNRAPVDT ALLADGDEIK IGKFRLAFLI       180
     TPPSAATDQ                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page