(data stored in ACNUC7421 zone)

EMBL: AP011115.PE610

AP011115.PE610       Location/Qualifiers
FT   CDS             629626..631167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48857"
FT                   /db_xref="InterPro:IPR013493"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASS5"
FT                   /protein_id="BAH48857.1"
FT                   /translation="MSESGSDPGRSPSGLRAARPAVAPPLRDDRLKLFSFATAEKRAEY
FT                   LWVLRAFDHARANYIVLLHAGDVARILDGLAGDDPAGQLGAGDVTPLLEQLHVWEVLER
FT                   SYDGTRAATLAEYLNRHFVYQFSQAGYQVFRAVEDALAARLDDASLSRLALPDLLADMN
FT                   DLAAANRAADNDLVYRKLNRLDATLSDMAGRAAQFYLTLGDLVRTTEITPETFMSHKDA
FT                   LLTHMREFSSDLSRYAPKLAAAIALVEDSGVEAMVARAAASDERVFLDVEEREADWRSR
FT                   WAGVTHWFVGSEAGPSESERLREGTMSAIAAVLSLLRRVTETRKGGVSRESQLRHLAGW
FT                   FAATPNEDAAHALFRAVFDLGRPRHLSMVHPDADIIPDTRSWWEAQPVEISRTLAETGR
FT                   PPSPGLPARVQRNEGSVRRLREEQLTAQRLRAAAAQSLARGGVYERELDEAETDVLLSL
FT                   LNAALTARVPVSGRVKSSTGSENGVKLTLSPHGESTVVRTARGRLHLDGLQVSVR"
     MSESGSDPGR SPSGLRAARP AVAPPLRDDR LKLFSFATAE KRAEYLWVLR AFDHARANYI        60
     VLLHAGDVAR ILDGLAGDDP AGQLGAGDVT PLLEQLHVWE VLERSYDGTR AATLAEYLNR       120
     HFVYQFSQAG YQVFRAVEDA LAARLDDASL SRLALPDLLA DMNDLAAANR AADNDLVYRK       180
     LNRLDATLSD MAGRAAQFYL TLGDLVRTTE ITPETFMSHK DALLTHMREF SSDLSRYAPK       240
     LAAAIALVED SGVEAMVARA AASDERVFLD VEEREADWRS RWAGVTHWFV GSEAGPSESE       300
     RLREGTMSAI AAVLSLLRRV TETRKGGVSR ESQLRHLAGW FAATPNEDAA HALFRAVFDL       360
     GRPRHLSMVH PDADIIPDTR SWWEAQPVEI SRTLAETGRP PSPGLPARVQ RNEGSVRRLR       420
     EEQLTAQRLR AAAAQSLARG GVYERELDEA ETDVLLSLLN AALTARVPVS GRVKSSTGSE       480
     NGVKLTLSPH GESTVVRTAR GRLHLDGLQV SVR                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page