(data stored in ACNUC7421 zone)

EMBL: AP011115.PE611

AP011115.PE611       Location/Qualifiers
FT   CDS             631164..632552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48858"
FT                   /db_xref="InterPro:IPR013494"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASS6"
FT                   /protein_id="BAH48858.1"
FT                   /translation="MKAREISPLALDSYQRAARVILSNHLVTQTYPDRIALPLLRRWAT
FT                   ELREDLMTLFGYRLEVTETTARLFTVSDRLDAGTPAKTATDRTFDRYRYAYLALALAAL
FT                   GRAGNQITLSELADHVAADAAQVEGVDLSTERASDRDAFVDAVGWLAARGAIALADGDA
FT                   GGWAANPDAGEALYDIDRSVVIALFRPPRALQHLRSIRGLLAGADSVTDEDTAETSRTV
FT                   DVKETTRRVRRALVERPVVYAADLDDHELVQLALPRTAADVELLTGLVAERREEGVAMI
FT                   DSSGRLSDVRFPGTGTVAQVALLLAGEIADRVLDPDAAETARMPLPRGRSEDLVEQVDG
FT                   AIPQSGIFDSLAGHDGVEPAEPAPADRLFPVVEDQWITDTVRTLTERFGRTFAAGWQAD
FT                   PDGLGRAALALLERLRLTASVPGGVLALPALARYRGVVVTIRDRTPEIDLFQSSANDSE
FT                   DITA"
     MKAREISPLA LDSYQRAARV ILSNHLVTQT YPDRIALPLL RRWATELRED LMTLFGYRLE        60
     VTETTARLFT VSDRLDAGTP AKTATDRTFD RYRYAYLALA LAALGRAGNQ ITLSELADHV       120
     AADAAQVEGV DLSTERASDR DAFVDAVGWL AARGAIALAD GDAGGWAANP DAGEALYDID       180
     RSVVIALFRP PRALQHLRSI RGLLAGADSV TDEDTAETSR TVDVKETTRR VRRALVERPV       240
     VYAADLDDHE LVQLALPRTA ADVELLTGLV AERREEGVAM IDSSGRLSDV RFPGTGTVAQ       300
     VALLLAGEIA DRVLDPDAAE TARMPLPRGR SEDLVEQVDG AIPQSGIFDS LAGHDGVEPA       360
     EPAPADRLFP VVEDQWITDT VRTLTERFGR TFAAGWQADP DGLGRAALAL LERLRLTASV       420
     PGGVLALPAL ARYRGVVVTI RDRTPEIDLF QSSANDSEDI TA                          462
//

If you have problems or comments...

PBIL Back to PBIL home page