(data stored in ACNUC7421 zone)

EMBL: AP011115.PE612

AP011115.PE612       Location/Qualifiers
FT   CDS             632549..636706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48859"
FT                   /db_xref="InterPro:IPR013496"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASS7"
FT                   /protein_id="BAH48859.1"
FT                   /translation="MTSARFRPTRAGIINLWDYRDQEFSFADGRLVLRGPNGSGKTKAL
FT                   EVLFPFVFDGRIEPRRLNPFAGEERTMKSNLLYRGQESAYSYVWMEFCRGAKDDPEAVT
FT                   VGIGMRASRTNDKVTRWYFVADGRVGVDFSLLGTDDRPLTKKQLGEQIGTDSITDRPLD
FT                   YRAAIDARMFGLGVQRYDQLINLILTLRRPQLAKNLDPKGLSQALTDGLRPLDEQLVLE
FT                   AARSFSDMEEVGRALEGLAAADQAAQSFVGVYAKYLRQQARTDVDQLATRLDAVRSGIT
FT                   ALHGAAADRARSQESREAAEERFTVAERALDQANATLDALKRSTAYEGRTQLDDLAQAV
FT                   STLEKSTALQAEKARKAKATLEQRSEEHEKAGDAVTRAVEALAHAEDELHVAAEDAGIT
FT                   WTALPDTARADQLTAALRGHAEERDGDLRAVRAALATVERAATERTRADDAARRGQEQL
FT                   DTAKVAVLEAETAVESARSRCATELRSWWTEQSSLYAEIEAPAALFDALDTALRGIGDE
FT                   DAATLSETLTEQTRDAVDALRMRRQQYDRDAAAAAEAIAEYESVRAAIESEHDDAPPLP
FT                   AGRHDTRSGLTGAPLWRLVRFADGVDAAVAAGIEAALEAANLLDGWVPVDDALPDVESE
FT                   QFLVALPAGDRPTGRTLADVLEVEQDTGVPDDRVRGILESIALESLDPAEGPVGVAQDG
FT                   GYRQGIQRGRHTKSDAEYIGTTARARRRAARLVELDRTLAETRATLDDTRASAEAVAEL
FT                   LTRTTAAARALPRTGSILTALKKVTESAGALRSRTDTATAVGRELDQAIADLSAKEKQL
FT                   RATASTHRTPHVAREIDSLAAAVRHFEKQGEMVQRCRREHGKEVEHTRQSEDRLHEARG
FT                   NAEEYAEEAAVAEEVLAQQIQRLGTLRDTLGAGAEELDRQLEEAHARIEACKKEQRDAR
FT                   KADKDAGEAIGKAEGAYNTAVQTLRLALTETHADAAHLAPYARRDLLELLGVDGGHTWP
FT                   ASAAAWMSAEQLVYRIQNAGQDIPILPPEVDALFRALDSATDSVRVSDSARKSTRTALT
FT                   TALQDFDAQLAAAGQDYRLQWDAPDGLTVVQVQDDEGYSSIGEFAARIASARSDQELLL
FT                   TESERRILEDALLTGLAQQIHERTVDARELIARMGTEMRERRMSSGNTIGVHWVLADNL
FT                   DDSAKAISKLLERDTSALGPDELATMRAHFAHQIRTARAAHPERSYPEILASALDYRRW
FT                   RVFSFTLISGNGTEDRLTVARHSALSGGEQSVSLHLPLFAAAHVMLDSADPHAPRLLAL
FT                   DEAFAGVDDNGRAELLGLSVQFDLDLFMTGFDLWITYGGVPGCAHYDLAHSTAEQSVSA
FT                   TLLVWSDGELLAEHDGTDLAQALGSPLRRRVPTPAEGALEFA"
     MTSARFRPTR AGIINLWDYR DQEFSFADGR LVLRGPNGSG KTKALEVLFP FVFDGRIEPR        60
     RLNPFAGEER TMKSNLLYRG QESAYSYVWM EFCRGAKDDP EAVTVGIGMR ASRTNDKVTR       120
     WYFVADGRVG VDFSLLGTDD RPLTKKQLGE QIGTDSITDR PLDYRAAIDA RMFGLGVQRY       180
     DQLINLILTL RRPQLAKNLD PKGLSQALTD GLRPLDEQLV LEAARSFSDM EEVGRALEGL       240
     AAADQAAQSF VGVYAKYLRQ QARTDVDQLA TRLDAVRSGI TALHGAAADR ARSQESREAA       300
     EERFTVAERA LDQANATLDA LKRSTAYEGR TQLDDLAQAV STLEKSTALQ AEKARKAKAT       360
     LEQRSEEHEK AGDAVTRAVE ALAHAEDELH VAAEDAGITW TALPDTARAD QLTAALRGHA       420
     EERDGDLRAV RAALATVERA ATERTRADDA ARRGQEQLDT AKVAVLEAET AVESARSRCA       480
     TELRSWWTEQ SSLYAEIEAP AALFDALDTA LRGIGDEDAA TLSETLTEQT RDAVDALRMR       540
     RQQYDRDAAA AAEAIAEYES VRAAIESEHD DAPPLPAGRH DTRSGLTGAP LWRLVRFADG       600
     VDAAVAAGIE AALEAANLLD GWVPVDDALP DVESEQFLVA LPAGDRPTGR TLADVLEVEQ       660
     DTGVPDDRVR GILESIALES LDPAEGPVGV AQDGGYRQGI QRGRHTKSDA EYIGTTARAR       720
     RRAARLVELD RTLAETRATL DDTRASAEAV AELLTRTTAA ARALPRTGSI LTALKKVTES       780
     AGALRSRTDT ATAVGRELDQ AIADLSAKEK QLRATASTHR TPHVAREIDS LAAAVRHFEK       840
     QGEMVQRCRR EHGKEVEHTR QSEDRLHEAR GNAEEYAEEA AVAEEVLAQQ IQRLGTLRDT       900
     LGAGAEELDR QLEEAHARIE ACKKEQRDAR KADKDAGEAI GKAEGAYNTA VQTLRLALTE       960
     THADAAHLAP YARRDLLELL GVDGGHTWPA SAAAWMSAEQ LVYRIQNAGQ DIPILPPEVD      1020
     ALFRALDSAT DSVRVSDSAR KSTRTALTTA LQDFDAQLAA AGQDYRLQWD APDGLTVVQV      1080
     QDDEGYSSIG EFAARIASAR SDQELLLTES ERRILEDALL TGLAQQIHER TVDARELIAR      1140
     MGTEMRERRM SSGNTIGVHW VLADNLDDSA KAISKLLERD TSALGPDELA TMRAHFAHQI      1200
     RTARAAHPER SYPEILASAL DYRRWRVFSF TLISGNGTED RLTVARHSAL SGGEQSVSLH      1260
     LPLFAAAHVM LDSADPHAPR LLALDEAFAG VDDNGRAELL GLSVQFDLDL FMTGFDLWIT      1320
     YGGVPGCAHY DLAHSTAEQS VSATLLVWSD GELLAEHDGT DLAQALGSPL RRRVPTPAEG      1380
     ALEFA                                                                  1385
//

If you have problems or comments...

PBIL Back to PBIL home page