(data stored in ACNUC7421 zone)

EMBL: AP011115.PE614

AP011115.PE614       Location/Qualifiers
FT   CDS             complement(638066..638869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48861"
FT                   /db_xref="InterPro:IPR022292"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASS9"
FT                   /protein_id="BAH48861.1"
FT                   /translation="MPAEESDPLESGELTLIGQITHASNATLVCDAAAGENTVRCVYKP
FT                   VRGERPLWDFPDGTLAGREYASYLVSEQLGWGVIPRTLLRDGPFGPGMVQRWVDTPDRH
FT                   ADDTGGLDLVDICAPDAIPEGWFEILRATDMDGEPVALIHADDPRLQRMAVLDVLINNA
FT                   DRKGGHALEGLDGSVYGVDHGICLHTENKLRTVLWGWAGTDVPGALVVDIAELISSLEG
FT                   DFGARLGEHITSDEVAALYERAVDLLAAPVMPRPNGHRPIPWPAF"
     MPAEESDPLE SGELTLIGQI THASNATLVC DAAAGENTVR CVYKPVRGER PLWDFPDGTL        60
     AGREYASYLV SEQLGWGVIP RTLLRDGPFG PGMVQRWVDT PDRHADDTGG LDLVDICAPD       120
     AIPEGWFEIL RATDMDGEPV ALIHADDPRL QRMAVLDVLI NNADRKGGHA LEGLDGSVYG       180
     VDHGICLHTE NKLRTVLWGW AGTDVPGALV VDIAELISSL EGDFGARLGE HITSDEVAAL       240
     YERAVDLLAA PVMPRPNGHR PIPWPAF                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page