(data stored in ACNUC7421 zone)

EMBL: AP011115.PE615

AP011115.PE615       Location/Qualifiers
FT   CDS             complement(638873..639466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48862"
FT                   /db_xref="InterPro:IPR021441"
FT                   /db_xref="UniProtKB/TrEMBL:C1AST0"
FT                   /protein_id="BAH48862.1"
FT                   /translation="MSRAIHVFRTPDRFIAGTVGEPGDRSFYLQAVHEARVISVLLEKQ
FT                   QVQVLADRMGLLLEEVHRRFGTDVPPEGAELDDSSPLVTPIDAEFRVGTMGLGWDADAG
FT                   AVVVELLAVSETEFDESVVLDDSEDGPDAVRVFLTPLQARDFSLRSERVIAAGRAPCPL
FT                   CGEPLAPEGHICIRTNGYRRGQSFGLTPEMDEED"
     MSRAIHVFRT PDRFIAGTVG EPGDRSFYLQ AVHEARVISV LLEKQQVQVL ADRMGLLLEE        60
     VHRRFGTDVP PEGAELDDSS PLVTPIDAEF RVGTMGLGWD ADAGAVVVEL LAVSETEFDE       120
     SVVLDDSEDG PDAVRVFLTP LQARDFSLRS ERVIAAGRAP CPLCGEPLAP EGHICIRTNG       180
     YRRGQSFGLT PEMDEED                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page