(data stored in ACNUC7421 zone)

EMBL: AP011115.PE616

AP011115.PE616       Location/Qualifiers
FT   CDS             complement(639592..640290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06160"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48863"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR022492"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C1AST1"
FT                   /protein_id="BAH48863.1"
FT                   /translation="MTVVLLRHGRSTSNTAHTLAGRSPGVELDDRGREQAQAIVARLAD
FT                   VAIEEIVRSPLVRCEQTVEPLARARGLTPVVEHRLVEVDYGEWTGRELKVLLEEPLWKI
FT                   VQQHASAAVFPGGEGLAQVQARAVAAVREHDARLAELHGRDVVWVACSHGDVIKSVLAD
FT                   ALGAHLDGFQRIVAEPASISVVRYTSTRPYVLKMNDTGADLSGVNTPPVSGDGARAEVS
FT                   GSVPGGEVRL"
     MTVVLLRHGR STSNTAHTLA GRSPGVELDD RGREQAQAIV ARLADVAIEE IVRSPLVRCE        60
     QTVEPLARAR GLTPVVEHRL VEVDYGEWTG RELKVLLEEP LWKIVQQHAS AAVFPGGEGL       120
     AQVQARAVAA VREHDARLAE LHGRDVVWVA CSHGDVIKSV LADALGAHLD GFQRIVAEPA       180
     SISVVRYTST RPYVLKMNDT GADLSGVNTP PVSGDGARAE VSGSVPGGEV RL               232
//

If you have problems or comments...

PBIL Back to PBIL home page