(data stored in ACNUC7421 zone)

EMBL: AP011115.PE627

AP011115.PE627       Location/Qualifiers
FT   CDS             complement(649055..649585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48874"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASU2"
FT                   /protein_id="BAH48874.1"
FT                   /translation="MSHDPYEALPDLPSFELTSTDVTDGQPLNKEQVSGIFGAGGHDNS
FT                   PQLSWSGFPAETKSFAVTVYDPDAPTASGFWHWAVANIPADTTTLVSGAGDDDGTGLPS
FT                   GAITLKNDAGLSRFLGAAPPAGHGPHRYIIVVHAVDVEILDGVTADSTPAFLGFNLFSH
FT                   AIARAKIQGTYEQ"
     MSHDPYEALP DLPSFELTST DVTDGQPLNK EQVSGIFGAG GHDNSPQLSW SGFPAETKSF        60
     AVTVYDPDAP TASGFWHWAV ANIPADTTTL VSGAGDDDGT GLPSGAITLK NDAGLSRFLG       120
     AAPPAGHGPH RYIIVVHAVD VEILDGVTAD STPAFLGFNL FSHAIARAKI QGTYEQ           176
//

If you have problems or comments...

PBIL Back to PBIL home page