(data stored in ACNUC7421 zone)

EMBL: AP011115.PE628

AP011115.PE628       Location/Qualifiers
FT   CDS             complement(649620..650972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06280"
FT                   /product="peptidase M20 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48875"
FT                   /db_xref="GOA:C1ASU3"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASU3"
FT                   /protein_id="BAH48875.1"
FT                   /translation="MPTTQETPGQGRAEAEVVDLVSSLIRFDTSNTGELATTKGERECA
FT                   EWVASQLQEVGYETEYVESGAPGRGNVFARLKGSDPDRGALLLHGHLDVVPAEPADWRV
FT                   HPFSGAVEDGYVWGRGAVDMKDMVGMILAVARQFKAEGVVPPRDLVFAFVADEEAGGKY
FT                   GCQWLVENRPDLFEGVTEAVGEVGGFSLTVARPDGTDRRLYLVETAEKGLGWMRLTAKG
FT                   RAGHGSFLHGENAVTILAQAVARLGAHTFPLVMSDSVAEFLAAAGEETGLDFDPESPDL
FT                   DGTLAKLGTIANILGATLRDTANPTMLSAGYKANVIPQTAEAVVDCRILPGRQAEFEAT
FT                   VDELIGPDVTREWITKLDSYETTFDGHLVDAMNDAILAHDPGARTVPYMLSGGTDAKAF
FT                   AKLGIRCFGFAPLQLPADLDFSALFHGVDERVPVDALLFGTRVLEHFLLHS"
     MPTTQETPGQ GRAEAEVVDL VSSLIRFDTS NTGELATTKG ERECAEWVAS QLQEVGYETE        60
     YVESGAPGRG NVFARLKGSD PDRGALLLHG HLDVVPAEPA DWRVHPFSGA VEDGYVWGRG       120
     AVDMKDMVGM ILAVARQFKA EGVVPPRDLV FAFVADEEAG GKYGCQWLVE NRPDLFEGVT       180
     EAVGEVGGFS LTVARPDGTD RRLYLVETAE KGLGWMRLTA KGRAGHGSFL HGENAVTILA       240
     QAVARLGAHT FPLVMSDSVA EFLAAAGEET GLDFDPESPD LDGTLAKLGT IANILGATLR       300
     DTANPTMLSA GYKANVIPQT AEAVVDCRIL PGRQAEFEAT VDELIGPDVT REWITKLDSY       360
     ETTFDGHLVD AMNDAILAHD PGARTVPYML SGGTDAKAFA KLGIRCFGFA PLQLPADLDF       420
     SALFHGVDER VPVDALLFGT RVLEHFLLHS                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page