(data stored in ACNUC7421 zone)

EMBL: AP011115.PE629

AP011115.PE629       Location/Qualifiers
FT   CDS             651243..652697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48876"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASU4"
FT                   /protein_id="BAH48876.1"
FT                   /translation="MGETTTTIDPADLEICLKVLDLAAELDDADPDSVTVQRAVGHLFK
FT                   KLKKRRRIAARDAVSEADRKVVAATATGSPDRIDDETAGIPLTSNADGASAGTLIRPRP
FT                   CYICKQRYTRVDAFYHQLCPECATKSRAKRDARADLTGRRALLTGGRAKIGMYIALRLL
FT                   RDGAHTTITTRFPNDAIRRFKAMEDSSEWIHRLRVVGIDLRDPAQVVALADSVAAQGPL
FT                   DILINNAAQTVRRSPGAYSALADAESGALPSGDLPDVLTFGKTSDAHPAALAGSLSDVS
FT                   VMAGAALSPDAVSSLALVAKSASPDRIDQGLAIDAGGLLPDLAHTNSWVQTVEEVDPIE
FT                   LLEVQLCNSVAPFILVSRLRPAMAAAGARRKYVVNVSAMEGQFSRAYKGPGHPHTNMAK
FT                   AALNMLTRTSAKEMLEDGILMTAVDTGWITDERPHYTKMRLADEGFHAPLDLVDGAARV
FT                   YDPIVQGEQGVDLHGCFLKDYEPSPW"
     MGETTTTIDP ADLEICLKVL DLAAELDDAD PDSVTVQRAV GHLFKKLKKR RRIAARDAVS        60
     EADRKVVAAT ATGSPDRIDD ETAGIPLTSN ADGASAGTLI RPRPCYICKQ RYTRVDAFYH       120
     QLCPECATKS RAKRDARADL TGRRALLTGG RAKIGMYIAL RLLRDGAHTT ITTRFPNDAI       180
     RRFKAMEDSS EWIHRLRVVG IDLRDPAQVV ALADSVAAQG PLDILINNAA QTVRRSPGAY       240
     SALADAESGA LPSGDLPDVL TFGKTSDAHP AALAGSLSDV SVMAGAALSP DAVSSLALVA       300
     KSASPDRIDQ GLAIDAGGLL PDLAHTNSWV QTVEEVDPIE LLEVQLCNSV APFILVSRLR       360
     PAMAAAGARR KYVVNVSAME GQFSRAYKGP GHPHTNMAKA ALNMLTRTSA KEMLEDGILM       420
     TAVDTGWITD ERPHYTKMRL ADEGFHAPLD LVDGAARVYD PIVQGEQGVD LHGCFLKDYE       480
     PSPW                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page