(data stored in ACNUC7421 zone)

EMBL: AP011115.PE63

AP011115.PE63        Location/Qualifiers
FT   CDS             53730..54014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48310"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS61"
FT                   /protein_id="BAH48310.1"
FT                   /translation="MPVFVVEYTYSPETSSGRDDHRTDHHAWLAELVRRKVVLSSDPLA
FT                   DHTGVQFIVDAADEDTVTRLFTHDPFAQANLVSKVLISKWHPVIGEIHD"
     MPVFVVEYTY SPETSSGRDD HRTDHHAWLA ELVRRKVVLS SDPLADHTGV QFIVDAADED        60
     TVTRLFTHDP FAQANLVSKV LISKWHPVIG EIHD                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page