(data stored in ACNUC7421 zone)

EMBL: AP011115.PE633

AP011115.PE633       Location/Qualifiers
FT   CDS             655260..656225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06330"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48880"
FT                   /db_xref="GOA:C1ASU8"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASU8"
FT                   /protein_id="BAH48880.1"
FT                   /translation="MFKLLIFTLVGVGAQLVDGALGMAFGVTATTLLVFSGVGPAHASA
FT                   AVHFAEVGTTLASGASHWRFRNIDWPLVLRLGVPGAIGAFLGATVLSQLSTAAAVPVTS
FT                   TILLAIGVYVLLRFSIRPPAVNDARTSPHTAKFLSPLGLFGGFIDASGGGGWGPITTST
FT                   LLSRGKTAPRTVIGSVSASEFLVSAAASIGFIFGLGSDFFDNIPIIAGLALGGIIAAPV
FT                   AAWLVSRVPATLLGTGVGGIIIITNAQKLFKTFEVTGVVATLGYIALVAVWAGLLVVAW
FT                   RRSRLSAAEAAGDLHRIDTEIDTPSEPETQSLEPSTGEKA"
     MFKLLIFTLV GVGAQLVDGA LGMAFGVTAT TLLVFSGVGP AHASAAVHFA EVGTTLASGA        60
     SHWRFRNIDW PLVLRLGVPG AIGAFLGATV LSQLSTAAAV PVTSTILLAI GVYVLLRFSI       120
     RPPAVNDART SPHTAKFLSP LGLFGGFIDA SGGGGWGPIT TSTLLSRGKT APRTVIGSVS       180
     ASEFLVSAAA SIGFIFGLGS DFFDNIPIIA GLALGGIIAA PVAAWLVSRV PATLLGTGVG       240
     GIIIITNAQK LFKTFEVTGV VATLGYIALV AVWAGLLVVA WRRSRLSAAE AAGDLHRIDT       300
     EIDTPSEPET QSLEPSTGEK A                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page