(data stored in ACNUC7421 zone)

EMBL: AP011115.PE635

AP011115.PE635       Location/Qualifiers
FT   CDS             658665..660452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48882"
FT                   /db_xref="GOA:C1ASV0"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASV0"
FT                   /protein_id="BAH48882.1"
FT                   /translation="MGQHRGESRARGISKGPLIVLGLVVVLVLGVLGWFQLRDRINDQG
FT                   AAAAGACVEGESVLAVAADPDIAPQLQTLADHYAETAPVIRDQCVSVTVTAVASDTVRD
FT                   ALAAGPDGPWDAAAFGPRPALWIPSSSHSVKQLSATGVISGEARPLASSPVVLAVRTAF
FT                   ANAPGTAALDWKDLPSLQSGRDALATLGLPGWGGLGLALPVGPGAESTEMAVEAVAAAV
FT                   TGSSTGPVTEEQARSVPVTSALTDLALGYEASTGAKPATTREALTALAEQGDPATSAIH
FT                   AVATTEQQVYQALRDAPGADITTSMPKGPTPVADHPAAVLAGPAVDETQSRAAAQFAEF
FT                   VRRPEQAQVLADAGFRVEGLARPDDTTLAFPGVESALVPADAAAAAELMQVIRNPISPR
FT                   TSTILLDVSSSMGEREGTSTRLANTTMALAAHVDQSPDSSNLGLWEYSTTLDGSRPYTT
FT                   VVATGPLSAGGFTEGTRRQALDARLARATSATGSSTYTSLEAAYKSAVDGYTPGRTNSV
FT                   LLVTDGANDDSVSRAELLSAIAASSSMSKPVRIDVVTIGENPDLNTLQALADRTGGSLE
FT                   KVTTSDGAALPTAISKLLS"
     MGQHRGESRA RGISKGPLIV LGLVVVLVLG VLGWFQLRDR INDQGAAAAG ACVEGESVLA        60
     VAADPDIAPQ LQTLADHYAE TAPVIRDQCV SVTVTAVASD TVRDALAAGP DGPWDAAAFG       120
     PRPALWIPSS SHSVKQLSAT GVISGEARPL ASSPVVLAVR TAFANAPGTA ALDWKDLPSL       180
     QSGRDALATL GLPGWGGLGL ALPVGPGAES TEMAVEAVAA AVTGSSTGPV TEEQARSVPV       240
     TSALTDLALG YEASTGAKPA TTREALTALA EQGDPATSAI HAVATTEQQV YQALRDAPGA       300
     DITTSMPKGP TPVADHPAAV LAGPAVDETQ SRAAAQFAEF VRRPEQAQVL ADAGFRVEGL       360
     ARPDDTTLAF PGVESALVPA DAAAAAELMQ VIRNPISPRT STILLDVSSS MGEREGTSTR       420
     LANTTMALAA HVDQSPDSSN LGLWEYSTTL DGSRPYTTVV ATGPLSAGGF TEGTRRQALD       480
     ARLARATSAT GSSTYTSLEA AYKSAVDGYT PGRTNSVLLV TDGANDDSVS RAELLSAIAA       540
     SSSMSKPVRI DVVTIGENPD LNTLQALADR TGGSLEKVTT SDGAALPTAI SKLLS            595
//

If you have problems or comments...

PBIL Back to PBIL home page