(data stored in ACNUC7421 zone)

EMBL: AP011115.PE636

AP011115.PE636       Location/Qualifiers
FT   CDS             660449..661603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06360"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48883"
FT                   /db_xref="GOA:C1ASV1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASV1"
FT                   /protein_id="BAH48883.1"
FT                   /translation="MTRLLVFAVFLALVTWWLHRRLVRATGLGRPWSVIVDLALVALWV
FT                   LAVIGVGSGEAFDPGWARPPGWAGWVWLGAMFYLVLGLLLVAVVSLLTRLFARVRGGGH
FT                   DEQVDLSRRRGLRIATAVVVVGAVGAAGYGVREAARPRIVRVRVPLQRLPAEFEGVRVA
FT                   LVSDLHVGPARGVDFTRRVVDLVNAERPDLVAIAGDLVDGTVAKVAPDLQPLGDLEAPL
FT                   GVFGVSGNHEFYADDGGRWLDVWDRLGIRTLRNEHATLTRGGAAIDIAGIHDYSSPAPY
FT                   EPDLPAALAGRDPSTFVVLLAHEPRQALEASDLGVDLQLSGHTHGGQMWPLGYLVPLQQ
FT                   PSVTGLDRIGNTVLYTTRGVGAWGPPVRVGAPPEITILELVRAD"
     MTRLLVFAVF LALVTWWLHR RLVRATGLGR PWSVIVDLAL VALWVLAVIG VGSGEAFDPG        60
     WARPPGWAGW VWLGAMFYLV LGLLLVAVVS LLTRLFARVR GGGHDEQVDL SRRRGLRIAT       120
     AVVVVGAVGA AGYGVREAAR PRIVRVRVPL QRLPAEFEGV RVALVSDLHV GPARGVDFTR       180
     RVVDLVNAER PDLVAIAGDL VDGTVAKVAP DLQPLGDLEA PLGVFGVSGN HEFYADDGGR       240
     WLDVWDRLGI RTLRNEHATL TRGGAAIDIA GIHDYSSPAP YEPDLPAALA GRDPSTFVVL       300
     LAHEPRQALE ASDLGVDLQL SGHTHGGQMW PLGYLVPLQQ PSVTGLDRIG NTVLYTTRGV       360
     GAWGPPVRVG APPEITILEL VRAD                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page