(data stored in ACNUC7421 zone)

EMBL: AP011115.PE639

AP011115.PE639       Location/Qualifiers
FT   CDS             complement(665762..666235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48886"
FT                   /db_xref="GOA:C1ASV4"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASV4"
FT                   /protein_id="BAH48886.1"
FT                   /translation="MSEMHVIGVRVEQPQNQPVLLLRETDGERYLPIWIGQTEATAIAL
FT                   EQQGVEPARPLTHDLIKNLIEAFGRTLKEVRIVDLREGTFYADLVFDQNTRVSARPSDS
FT                   IAIALRVGVPIFAEEAVLTEAGLVMPDEREDEVEKFKEFLESVSPDDFKATDG"
     MSEMHVIGVR VEQPQNQPVL LLRETDGERY LPIWIGQTEA TAIALEQQGV EPARPLTHDL        60
     IKNLIEAFGR TLKEVRIVDL REGTFYADLV FDQNTRVSAR PSDSIAIALR VGVPIFAEEA       120
     VLTEAGLVMP DEREDEVEKF KEFLESVSPD DFKATDG                                157
//

If you have problems or comments...

PBIL Back to PBIL home page