(data stored in ACNUC7421 zone)

EMBL: AP011115.PE64

AP011115.PE64        Location/Qualifiers
FT   CDS             complement(54271..54684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48311"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS62"
FT                   /protein_id="BAH48311.1"
FT                   /translation="MCAAKVASSVMQVAELDRSVKYYCDVFGCRVAVREPDAALLLTPD
FT                   NFQIYMYAKKGASTRRGVSVIGVHYVMWAADTEDELERITERLHAYDATTYTQTVGGVT
FT                   FVDGCDPDGIRVIVAYPGPEQLPRELIAQRFRG"
     MCAAKVASSV MQVAELDRSV KYYCDVFGCR VAVREPDAAL LLTPDNFQIY MYAKKGASTR        60
     RGVSVIGVHY VMWAADTEDE LERITERLHA YDATTYTQTV GGVTFVDGCD PDGIRVIVAY       120
     PGPEQLPREL IAQRFRG                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page