(data stored in ACNUC7421 zone)

EMBL: AP011115.PE643

AP011115.PE643       Location/Qualifiers
FT   CDS             complement(668385..669131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06430"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48890"
FT                   /db_xref="GOA:C1ASV8"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASV8"
FT                   /protein_id="BAH48890.1"
FT                   /translation="MSGHEGRHELHGTEPTTSRRSHVVFALLAALLLGGLGIAIVTQVK
FT                   NTGSGDTLDSASPADLLVVLDTLNQREAALRQEIASLEQTLATLQQSGSSGAALDEAQA
FT                   RLTALSIQVGSAPATGPGVTMRITDPNRGVGSEVLLDLVQELRAAGAEAIQVQGADGPP
FT                   IRIGVDSWVSGSAGGVSVDGRKVNAPYGVVAIGDPPTLAAALNIPGGVVDTVARSGGQL
FT                   TIEQSQQVTISALREAKPRQYAQPGN"
     MSGHEGRHEL HGTEPTTSRR SHVVFALLAA LLLGGLGIAI VTQVKNTGSG DTLDSASPAD        60
     LLVVLDTLNQ REAALRQEIA SLEQTLATLQ QSGSSGAALD EAQARLTALS IQVGSAPATG       120
     PGVTMRITDP NRGVGSEVLL DLVQELRAAG AEAIQVQGAD GPPIRIGVDS WVSGSAGGVS       180
     VDGRKVNAPY GVVAIGDPPT LAAALNIPGG VVDTVARSGG QLTIEQSQQV TISALREAKP       240
     RQYAQPGN                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page