(data stored in ACNUC7421 zone)

EMBL: AP011115.PE644

AP011115.PE644       Location/Qualifiers
FT   CDS             complement(669139..669501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06440"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48891"
FT                   /db_xref="GOA:C1ASV9"
FT                   /db_xref="InterPro:IPR009709"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASV9"
FT                   /protein_id="BAH48891.1"
FT                   /translation="MKAALKGGSAIYGVLALIVGIVLGVVFSPQVPDAVQPYLPIAVVA
FT                   ALDAVFGGLRAYLDEIFDSKVFVVSFVFNVLVAALIVWLGDQLGVGTQLSTAIVVVLGI
FT                   RIFGNAAALRRRLFGA"
     MKAALKGGSA IYGVLALIVG IVLGVVFSPQ VPDAVQPYLP IAVVAALDAV FGGLRAYLDE        60
     IFDSKVFVVS FVFNVLVAAL IVWLGDQLGV GTQLSTAIVV VLGIRIFGNA AALRRRLFGA       120
//

If you have problems or comments...

PBIL Back to PBIL home page