(data stored in ACNUC7421 zone)

EMBL: AP011115.PE645

AP011115.PE645       Location/Qualifiers
FT   CDS             complement(669534..670397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06450"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48892"
FT                   /db_xref="GOA:C1ASW0"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASW0"
FT                   /protein_id="BAH48892.1"
FT                   /translation="MKRTESGVRRNPVPSLLQSLMNDHLDPGYEGAAEDREHGHSRQTR
FT                   VGRQVWIAIGALLVGLVLSVAYRQATERIPGTEQVRSELLSKVQDAEDRAGALAATRDT
FT                   LSAQADDARATALAGDARGAALLDELRGLEGDAGVEAVHGPGLTVTLTDPAAKPNLSDS
FT                   SQRSVGGKAVVLDRDLQSVVNSLWAGGAEAIAVGDVRIGPSVTIRQAGGAMLVDNQPVF
FT                   SPYVVSAIGPQGPMQTGFVVSDAYLRMSSVAQLYGIGFAVAEADDLHLPAAPAREVRAA
FT                   REAGTR"
     MKRTESGVRR NPVPSLLQSL MNDHLDPGYE GAAEDREHGH SRQTRVGRQV WIAIGALLVG        60
     LVLSVAYRQA TERIPGTEQV RSELLSKVQD AEDRAGALAA TRDTLSAQAD DARATALAGD       120
     ARGAALLDEL RGLEGDAGVE AVHGPGLTVT LTDPAAKPNL SDSSQRSVGG KAVVLDRDLQ       180
     SVVNSLWAGG AEAIAVGDVR IGPSVTIRQA GGAMLVDNQP VFSPYVVSAI GPQGPMQTGF       240
     VVSDAYLRMS SVAQLYGIGF AVAEADDLHL PAAPAREVRA AREAGTR                     287
//

If you have problems or comments...

PBIL Back to PBIL home page