(data stored in ACNUC7421 zone)

EMBL: AP011115.PE646

AP011115.PE646       Location/Qualifiers
FT   CDS             complement(670397..671020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06460"
FT                   /product="putative phosphatidylglycerophosphate synthase"
FT                   /EC_number="2.7.8.5"
FT                   /note="protein synonym:CDP-diacylglycerol--glycerol-3-
FT                   phosphate 3-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48893"
FT                   /db_xref="GOA:C1ASW1"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASW1"
FT                   /protein_id="BAH48893.1"
FT                   /translation="MNSVDRDTARSDRIVTVPNLLSVVRLLGVPLFVYLLLVTHSDGWA
FT                   LAILMISGFTDWLDGKLARILDQSSKLGALLDPFVDRLYVVTTLVTFVVRGFIPWWVAA
FT                   ILIGRDAVLALTLLIYRRRGLPPPDVMYLGKGATFLLMFALPMTLAAQGDWSIATVAQP
FT                   LAAALLVWGTVLYVWTGLLYTVNAVTVARTVPARGSGGDEREAR"
     MNSVDRDTAR SDRIVTVPNL LSVVRLLGVP LFVYLLLVTH SDGWALAILM ISGFTDWLDG        60
     KLARILDQSS KLGALLDPFV DRLYVVTTLV TFVVRGFIPW WVAAILIGRD AVLALTLLIY       120
     RRRGLPPPDV MYLGKGATFL LMFALPMTLA AQGDWSIATV AQPLAAALLV WGTVLYVWTG       180
     LLYTVNAVTV ARTVPARGSG GDEREAR                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page