(data stored in ACNUC7421 zone)

EMBL: AP011115.PE647

AP011115.PE647       Location/Qualifiers
FT   CDS             complement(671153..672211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48894"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASW2"
FT                   /protein_id="BAH48894.1"
FT                   /translation="MTFFESLARKLDRTGVDPVVWHAPPPPPLTGVLAPNGVLDGVHRW
FT                   ALPAGEGPEDVAVDHDGRVVTGGNDGRIWRFDSRGDATELANTGGRPLGVEVLDDGRYL
FT                   ICDAERGVLRVDEKGRIDVLADTAVGRPLVACNNSAVGRDGTVYFTDSSAHFTIADHRY
FT                   DLLEHRGTGRLLRLDPRTGETDLLAEGLQFANGVGLASDESFVLVAETGSYQISRVDLA
FT                   GPSQGSTSVWAENLPGIPDNMTSQTHDGLFWVALYSPRMRLLDLLAPYPALRIVAANLP
FT                   EAVQPNPVHAGWVVALDQRGRIVHSLRGGKGSYAPVTGVREHDGWLYLGSLTADAVARV
FT                   PAPPRPHIAAGE"
     MTFFESLARK LDRTGVDPVV WHAPPPPPLT GVLAPNGVLD GVHRWALPAG EGPEDVAVDH        60
     DGRVVTGGND GRIWRFDSRG DATELANTGG RPLGVEVLDD GRYLICDAER GVLRVDEKGR       120
     IDVLADTAVG RPLVACNNSA VGRDGTVYFT DSSAHFTIAD HRYDLLEHRG TGRLLRLDPR       180
     TGETDLLAEG LQFANGVGLA SDESFVLVAE TGSYQISRVD LAGPSQGSTS VWAENLPGIP       240
     DNMTSQTHDG LFWVALYSPR MRLLDLLAPY PALRIVAANL PEAVQPNPVH AGWVVALDQR       300
     GRIVHSLRGG KGSYAPVTGV REHDGWLYLG SLTADAVARV PAPPRPHIAA GE               352
//

If you have problems or comments...

PBIL Back to PBIL home page