(data stored in ACNUC7421 zone)

EMBL: AP011115.PE65

AP011115.PE65        Location/Qualifiers
FT   CDS             55023..55382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00650"
FT                   /product="carboxymuconolactone decarboxylase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48312"
FT                   /db_xref="GOA:C1AS63"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS63"
FT                   /protein_id="BAH48312.1"
FT                   /translation="MPESLYQPTTTEISERRKALAPGIHDAFENFSRAVFADGALPEKT
FT                   KQLIAVAVAHVTQCPYCITGHTKLARRKGAEPEEIMEAIWVAAEMRAGGAFAHSTLALN
FT                   AMNHSGHTSTGEPEP"
     MPESLYQPTT TEISERRKAL APGIHDAFEN FSRAVFADGA LPEKTKQLIA VAVAHVTQCP        60
     YCITGHTKLA RRKGAEPEEI MEAIWVAAEM RAGGAFAHST LALNAMNHSG HTSTGEPEP        119
//

If you have problems or comments...

PBIL Back to PBIL home page