(data stored in ACNUC7421 zone)

EMBL: AP011115.PE650

AP011115.PE650       Location/Qualifiers
FT   CDS             complement(674504..675625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48897"
FT                   /db_xref="GOA:C1ASW5"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASW5"
FT                   /protein_id="BAH48897.1"
FT                   /translation="MTDKKPVIVYGVSGYTGRLVCEYLREFNIPFVAAGRDKKRIQEVL
FT                   DRVPGLDTVDHDVVEVEHTVPALTELFSGARVVSNMVGPFIKYGAVVVEAALAAGCHYT
FT                   DTTGEQDWVLDVQAKFGDQFAEKGLLLSPGVAQMYTTGEIAANIALETPGLDTLDILVL
FT                   WKGFPTYASTQTIFTILKADWYYLEQNRYAKWDPGTTFDVVVPGQHQMALALPWGGTCH
FT                   PVWFKDDPRVANVKAAGGVFDRSVMEGVVATQKMVEEQIKTLPADEQDAALAEIAGSVQ
FT                   AGMPPRENPRVNTSLDSVYASGPLGRAHCVIHGNCNYKQTGLLQAYAAHSLLQQPPKKT
FT                   GLASACQAFGHRELLGILRSFGLVMEPVVTVQN"
     MTDKKPVIVY GVSGYTGRLV CEYLREFNIP FVAAGRDKKR IQEVLDRVPG LDTVDHDVVE        60
     VEHTVPALTE LFSGARVVSN MVGPFIKYGA VVVEAALAAG CHYTDTTGEQ DWVLDVQAKF       120
     GDQFAEKGLL LSPGVAQMYT TGEIAANIAL ETPGLDTLDI LVLWKGFPTY ASTQTIFTIL       180
     KADWYYLEQN RYAKWDPGTT FDVVVPGQHQ MALALPWGGT CHPVWFKDDP RVANVKAAGG       240
     VFDRSVMEGV VATQKMVEEQ IKTLPADEQD AALAEIAGSV QAGMPPRENP RVNTSLDSVY       300
     ASGPLGRAHC VIHGNCNYKQ TGLLQAYAAH SLLQQPPKKT GLASACQAFG HRELLGILRS       360
     FGLVMEPVVT VQN                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page